Download free
gray road in between green grass field during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

gray road in between green grass field during daytime

Download this free HD photo of scotland, glencoe, velká británie, and nature in Velká Británie by Alena Vavrdova (@alenavavrdova)

A map markerGlencoe, Scotland, Velká Británie
Calendar outlinedPublished on CameraCanon, EOS 5D Mark IV
SafetyFree to use under the Unsplash License
scotlandglencoevelká británieNature imagesHd grey wallpapersunitedkingdomTravel imagesvisitscotlandgreatbritainhikeroadgraveldirt roadslopeoutdoorsfreewayhighwayasphalttarmaccountrysidePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

viajera
253 images · Curated by carly n.
viajerabuildingtown
Scotland
96 images · Curated by Lyne Lafreniere
scotlandoutdoorHd scenery wallpapers
Scotland
29 images · Curated by Y. More
scotlandoutdoorHd scenery wallpapers