Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Ronald Gijezen's profile
Ronald Gijezen
ronaldgijezen
Edit image Plus sign for Unsplash+
Download free
gray rhinoceros standing
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

Photos, Animals

gray rhinoceros standing

Rhino with a snow-covered tusk, Burgers’ Zoo

A map markerBurgers' Zoo, Arnhem, Netherlands
Calendar outlinedPublished on May 17, 2016 (UTC)SafetyFree to use under the Unsplash License
animaldarkwinteranimalssadwildlifegreyzoocoldanimal backgroundrhinoheadcold weatherwildsnowingrhinocerostoughrhinostuskrain forrestPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20