Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Myan Nguyen's profile
Myan Nguyen
mianismusic
Edit image Plus sign for Unsplash+
Download free
gray concrete road between green trees during daytime
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

gray concrete road between green trees during daytime

Download this free HD photo of green, life, vietnam, and park in Ho Chi Minh City, Vietnam by Myan Nguyen (@mianismusic)

A map markerTao Dan Park, Ho Chi Minh City, Vietnam
Calendar outlinedPublished on November 9, 2020 (UTC)CameraSafetyFree to use under the Unsplash License
greenlifevietnamparkhealthypeacefulemotionalwalkho chi minh cityempty streetmomentslow resolution2013foresthumanlandroadplantgardengreyPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20