Download free
gray concrete road between green trees during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

gray concrete road between green trees during daytime

Download this free HD photo of path, outdoors, vegetation, and plant by Annie Spratt (@anniespratt)

Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON Z 7
SafetyFree to use under the Unsplash License
pathoutdoorsvegetationplantNature imagesHd forest wallpaperswoodlandTree images & pictureslandGrass backgroundsgroveparklawngardentarmacasphaltroadstreetbuildingurbanPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Looking up
42 images · Curated by Leonie Rixon
looking upbuildingHd windows wallpapers
Still Waters
120 images · Curated by Sharon Scott
still waterlakereflection