Download free
gray concrete road between green grass field during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

gray concrete road between green grass field during daytime

Download this free HD photo of grey, road, nature, and forest by Nikola Stojanovic (@joxnie)

Calendar outlinedPublished on CameraSONY, ILCE-6500
SafetyFree to use under the Unsplash License
Hd grey wallpapersroadNature imagesHd forest wallpapersfogLandscape images & picturesMountain images & picturesGrass backgroundsfreewayhighwayasphalttarmacoutdoorsplantfirTree images & picturesabiesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Photography-Cameras
61 images · Curated by Nicole Gladding
photography-cameracameraphotography