Download free
gray asphalt road under cloudy sky during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –
1,000,000+ Free Images › Travel Images

gray asphalt road under cloudy sky during daytime

Download this free HD photo of monument valley, arizona, états-unis, and road in Oljato-Monument Valley, Arizona, États-Unis by Pierre Jeanneret (@pierrejeanneret)

A map markerMonument Valley, Arizona, États-Unis
Calendar outlinedPublished on CameraOLYMPUS IMAGING CORP., E-PL1
SafetyFree to use under the Unsplash License
monument valleyarizonaétats-unisroadHd grey wallpapersusablue sky backgrounddesert landscapeasphalttarmachighwayfreewayoutdoorsNature imagesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Connections
3 images · Curated by John Parker
connectionHd grey wallpapersusa
Arizona
21 images · Curated by Jason Rusk
arizonaoutdoorDesert images
DAP Postkarte
5 images · Curated by C P
usanaturdraußen