Unsplash logo
Avatar of user Getty Images
Unsplash+
In collaboration with Getty Images
A lockDownload
Glass jar with cereals, reusable shopping bag with nuts, reusable coffee cup and bamboo leaves on wooden shelf. Zero waste concept, bulk store shopping. Sustainable lifestyle. Ban plastic

Glass jar with cereals, reusable shopping bag with nuts, reusable coffee cup and bamboo leaves on wooden shelf. Zero waste concept, bulk store shopping. Sustainable lifestyle. Ban plastic

Download this HD photo of homeware, organic, kitchen, and lifestyles by Getty Images (@gettyimages)

Calendar outlinedPublished on SafetyLicensed under the Unsplash+ License
homewareorganickitchenlifestylespackagewood - materialmanufactured objectmueslimerchandisehealthy eatingplasticenvironmentsustainable resourcescupshoppingbagplantmilkbeveragevegetablePublic domain images

From this series

Plus sign for Unsplash+
Bulk store shopping. Glass jar with cereals, textile reusable bags with nuts, reusable coffee cup and bamboo leaves on wooden shelf. Zero waste concept, sustainable lifestyle. Ban plastic

Related collections

Uplifting
86 images · Curated by Robert Milos
upliftingoutdoorHq background images
blooming life
124 images · Curated by Aziz Acharki
bloomingLife images & photosFlower images