Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Go to Megha Ajith's profile
Megha Ajith
megs7171
Edit image Plus sign for Unsplash+
Download free
five black bird flying on sky
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

Black & White, Animals, Color Theory

five black bird flying on sky

I was thinking about missing home and then I looked up in the sky and saw them. What a coincidence… sometimes nature can reflect your emotions

Calendar outlinedPublished on May 29, 2018 (UTC)SafetyFree to use under the Unsplash License
animalwhite backgroundbirdwhite wallpaperwildlifewhitegreyminimalflightmonochromeflamingofeatherflyingflywingbeakin flightwallpaperbackgroundartPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20