Download free
five assorted butterflies
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial, Experimental
HQ Background Images › Cool Backgrounds › Trippy Backgrounds

five assorted butterflies

Butterflies

Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D750
SafetyFree to use under the Unsplash License
Animals images & picturesmetamorphosisHd pattern wallpaperscolorfulbeautylayersHd wallpapersmultiplechangewingsvarietyflyingButterfly imagesHd art wallpapersinvertebrateclothingapparelmothBirds imagesmonarchPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Wildlife
3,723 images · Curated by Becca Merriman
wildlifeAnimals images & picturesmammal
spring
17 images · Curated by Magdalena Wacławska
Spring images & picturesFlower imagesplant
NYU Pick 6
76 images · Curated by Julia Keating
vegetableplantFood images & pictures