Download free
fire breathing dragon figure on building rooftop
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

fire breathing dragon figure on building rooftop

Gringott's Dragon throwing flames on Universal Studios

A map markerThe Wizarding World of Harry Potter, Orlando, United States of America
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D5300
SafetyFree to use under the Unsplash License
orlandothe wizarding world of harry potterunited states of americapotterbuildingDragon images & pictureswizardwizardingworldbankmagicmagicalairflyescapegringrottuniversalstudiosuniversal studiosHd yellow wallpapersPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Interesting and entertaining
259 photos · Curated by Volodymyr Tokar
humanHd grey wallpapersoutdoor
xx
13 photos · Curated by kae
xxLight backgroundsHd wood wallpapers
Soulverse
224 photos · Curated by Wrong Disco
soulverseHumainla personne