Download free
empty road under trees at daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

empty road under trees at daytime

Download this free HD photo of mahogany, man-made forest, nature, and bohol by Ian Nicole Reambonanza (@ianreambonanza)

Calendar outlinedPublished on CameraNikon, D5200
SafetyFree to use under the Unsplash License
mahoganyman-made forestNature imagesboholHd forest wallpapersbilarHd wood wallpaperseco-tourismitsmorefuninthephilippiensroadtarmacasphaltfreewayhighwayhumanPeople images & picturesHd green wallpapersplantPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Simple Things
10 images · Curated by Lauren Galvez
Flower imagesplantoutdoor