Download free
Empire State Building New York
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

Empire State Building New York

Download this free HD photo of city, chrysler building, building, and Street in New York, United States by Paulo Silva (@onevagabond)

A map markerChrysler Building, New York, United States
Calendar outlinedPublished on CameraCanon, EOS 7D
SafetyFree to use under the Unsplash License
Hd city wallpaperschrysler buildingbuildingStreeturbanasphalttarmacwalkwaypavementpathsidewalkoutdoorsnightdowntowntownroadfreewayhighwayhousinghigh risePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

United States
318 images · Curated by Paula Poeira
united stateoutdoorHd wallpapers
Ciudades
68 images · Curated by cuatro ingletes
ciudadeHd city wallpapersbuilding
dytopian
8 images · Curated by Natalia Loureiro
dytopianroadCloud pictures & images