Download free
woman in black and pink floral shirt standing on gray asphalt road during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

woman in black and pink floral shirt standing on gray asphalt road during daytime

desert walk.

A map markerSouth Sinai, Egypt
Calendar outlinedPublished on CameraApple, iPhone XS
SafetyFree to use under the Unsplash License
shortsapparelclothingPeople images & picturesfootweartarmacasphaltoutdoorsNature imageshighwayfreewaygraveldirt roadsoilphotophotographymountain rangeMountain images & picturesportraitfacePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20