Download free
person standing in front of building
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

person standing in front of building

Download this free HD photo of cannaregio, 1353, 30121 venezia ve and path in Venezia, Italy by Martino Pietropoli (@martino_pietropoli)

A map markerCannaregio, 1353, 30121 Venezia VE, Italy, Venezia
Calendar outlinedPublished on CameraApple, iPhone XS
SafetyFree to use under the Unsplash License
cannaregio135330121 venezia vepathwalkwaypavementsidewalkhumanPeople images & picturestownbuildingmetropolisurbanHd city wallpapersflooringcobblestoneLight backgroundscorridorfloorpedestrianPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

2507
103 photos · Curated by Paulo Henrique
2507Light backgroundsHd neon wallpapers