Download free
concrete bricks
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

concrete bricks

Download this free HD photo of grey, brick, hope, and way by Benjamin Yang (@benjaminyang)

Calendar outlinedPublished on CameraSONY, ILCE-7M3
SafetyFree to use under the Unsplash License
Hd grey wallpapersHd brick wallpapershopewayroadpathwalkwaysidewalkpavementcobblestonefloorHd wood wallpapersflagstoneplantpedestrianPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Sidewalk Images
5 images · Curated by Samantha Goldstein
sidewalkHd brick wallpapersHd grey wallpapers
KPC
32 images · Curated by Dasha G
kpcmotiftoit
Gen
10 images · Curated by K Anderson
genhumanhope