Download free
cloudy sky above city buildings near sea at dayime
– –––– –.
––– – ––– –––
– –––– –.
––– – ––– –––

Featured in

Photos
Unsplash › HD Wallpapers › HD Travel Wallpapers › HD City Wallpapers

cloudy sky above city buildings near sea at dayime

Download this free HD photo of chicago, city, united states, and building in Chicago, United States by Erol Ahmed (@erol)

A map markerChicago, United States
Calendar outlinedPublished on CameraCanon, EOS 6D
SafetyFree to use under the Unsplash License
HD Chicago WallpapersHD City Wallpapersunited statesbuildingurbancityscapeskyscraperviewarchitecturedowntownviewpointsteelCloud Pictures & ImagesSunset Images & PicturesHD Sky WallpapersvistapersepctiveusastructuremetropoliPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Cities
5 images · Curated by Joern Herrmann
HD City Wallpapersbuildingskyscraper
Daily Traveler
187 images · Curated by Diana Gerstacker
Travel ImagesoutdoorHD Wallpapers