Download free
cars parked on side of the road during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

cars parked on side of the road during daytime

Tried to imitate the anime style

A map markerKyoto, Japan
Calendar outlinedPublished on CameraSONY, ILCE-7M2
SafetyFree to use under the Unsplash License
kyotojapanHd grey wallpapersPeople images & pictureshumanpathstreetfreewaymachinewheelstreet photographyutilityHd japanese wallpaperspoleurbanismintersectionpavementsidewalkneighborhoodlamp postPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

candid
4 images · Curated by kazuha came home
candidstreetjapan
anime
12 images · Curated by ema alejandra
Hd anime wallpapersjapantokyo
f
51 images · Curated by qi liu
fHd wallpapersHq background images