Download free
white and gray dome building under blue sky during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

white and gray dome building under blue sky during daytime

Download this free HD photo of frederiks kirke, dänemark, copenhagen municipality, and frederiksgade in København, Dänemark by Sandra Grünewald (@elmuff)

A map markerFrederiks Kirke, Frederiksgade, Copenhagen Municipality, Dänemark
Calendar outlinedPublished on SafetyFree to use under the Unsplash License
frederiks kirkedänemarkcopenhagen municipalityfrederiksgadedenmarkkirkchurchcopenhagenarchitecturebuildingdomeHd blue wallpapersPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

starry night
120 images · Curated by sieun yoo
starrynightStar images
Portrait Orientation
2,327 images · Curated by Unsplash Archive
portraitFlower imagesHd grey wallpapers