Download free
a group of pots on a boat
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a group of pots on a boat

Download this free HD photo of ship, deck, vessel, and merchant by iSawRed (@isawred)

Calendar outlinedPublished on CameraCanon, EOS M3
SafetyFree to use under the Unsplash License
shipdeckvesselmerchantfairlead rollerbollardsBrown backgroundsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Water Journal
908 images · Curated by Water Journal
outdoorHd grey wallpaperssea
Books
608 images · Curated by Kelly Sikkema
Book images & photosreadingBible images