Download free
brown wooden bench near train station
ā€“ ā€“ā€“ ā€“ā€“ā€“ā€“
ā€“ā€“ā€“ ā€“ ā€“ā€“ā€“ ā€“ ā€“
ā€“ ā€“ā€“ ā€“ā€“ā€“ā€“
ā€“ā€“ā€“ ā€“ ā€“ā€“ā€“ ā€“ ā€“

brown wooden bench near train station

Arashiyama train station

A map markerArashiyama, Wakayanagi, Midori Ward, Sagamihara, Kanagawa, Japan
Calendar outlinedPublished on CameraSAMSUNG, NX300
SafetyFree to use under the Unsplash License
japanarashiyamawakayanagikanagawasagamiharamidori wardhumanPeople images & picturesvehicletransportationtraintrain stationterminalsubwaylightingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Facial Recognition
1,830 images Ā· Curated by Tim Mossholder
People images & pictureshumanman
Autumn
189 images Ā· Curated by Jeremy Beck
Hd autumn wallpapersplantflora
Law
80 images Ā· Curated by Adam Klimowski
lawofficebusiness