Download free
brown Brooklyn bridge at daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

brown Brooklyn bridge at daytime

View of the Brooklyn Bridge

A map markerBrooklyn Bridge, New York, USA
Calendar outlinedPublished on CameraSONY, ILCE-7M3
SafetyFree to use under the Unsplash License
usaNew york pictures & imagesbrooklyn bridgeHd blue wallpapersdumbobkfreedom towerbrooklynHd teal wallpapersroadbuildingHd city wallpapersurbantownstreetfreewayhandrailtarmacspiretowerPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

concierge
18 images · Curated by Clay Ostrom
conciergebuildingHd city wallpapers
New York
253 images · Curated by Natalia Grisales
New york pictures & imagesbuildingurban