Download free
brown bare trees near brown building under white clouds during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

brown bare trees near brown building under white clouds during daytime

Tunstall, Cloudy

A map markerTunstall, Stoke-on-Trent, UK
Calendar outlinedPublished on CameraSONY, ILCE-6000
SafetyFree to use under the Unsplash License
ukstoke-on-trenttunstallHd grey wallpapersroadtarmacasphaltfreewayhighwaytransportationvehicleautomobileCar images & picturesintersectionurbantrainbuildingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Minimal
776 images · Curated by Mo Ljungberg
minimalHd white wallpapersHd grey wallpapers
Pink
83 images · Curated by Cheryl Kirsten
Hd pink wallpapersFlower imagesplant