Download free
brown and white dome ceiling
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –
1,000,000+ Free Images › Travel Images › America Images & Photos

brown and white dome ceiling

Download this free HD photo of washington, district de columbia, états-unis, and capitol hill in Washington, États-Unis by Yael Clusman (@yohehehel)

A map markerCapitol Hill, Washington, District de Columbia, États-Unis
Calendar outlinedPublished on SafetyFree to use under the Unsplash License
washingtondistrict de columbiaétats-uniscapitol hillarchitectureHd art wallpapersmonumentusaunited statescapitolbuildingdomeBrown backgroundsrugapseHd yellow wallpapersarcharchedskylightvault ceilingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Washington, DC
82 images · Curated by Laura Dyer
washington dcbuildingdc
TEO
61 images · Curated by Agnieszka Czubak
teohumanBrown backgrounds
Shelf
37 images · Curated by Hamza Azamouz
shelfbuildingarchitecture