Download free
brown and white concrete building near green trees under white clouds during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

brown and white concrete building near green trees under white clouds during daytime

Download this free HD photo of street, bicycle, walkway, and path in Neustadt am Rübenberge, Germany by Nazrin Babashova (@kurokami04)

A map markerNeustadt am Rübenberge, Germany
Calendar outlinedPublished on Camera--,
SafetyFree to use under the Unsplash License
streetbicyclewalkwaypathsidewalkpavementflagstonecobblestonewheelflooringfloorbuildingurbantownHd city wallpapersvehicletransportationpedestriancorridordowntownPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Wine & Vineyards
31 images · Curated by Karsten Würth
winevineyardcanada