Download free
bottom view of skyscraper
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

bottom view of skyscraper

The photo was taken in Central, Hong Kong.

Calendar outlinedPublished on CameraFUJIFILM, X-T1
SafetyFree to use under the Unsplash License
buildingHd city wallpapersurbanHd grey wallpapersminimalskyscraperminimalismofficereflectionglassHd windows wallpaperslooking uparchitecturecorporatearchitectbenchtownhigh risePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Glass
56 images · Curated by Alexis Hix
glassHd windows wallpapersbuilding