Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Leonardo Yip's profile
Leonardo Yip
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
blue and white parachute
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

Photos

blue and white parachute

Peace

A map markerLake Molveno, Molveno, Italy
Calendar outlinedPublished on November 11, 2018 (UTC)CameraSafetyFree to use under the Unsplash License
wallpaperbackgroundbluecloudscloudsportpurpleminimalpastelflyingflyactivitycoloursflyerparaglidingparachuteextremeglideranimalbirdPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20