Download free
black car on road during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

black car on road during daytime

Download this free HD photo of pacific coast highway, los angeles, united states, and road in Los Angeles, United States by Oscar O'Neill (@oscaroneill)

A map markerPacific Coast Highway, Los Angeles, United States
Calendar outlinedPublished on CameraApple, iPhone 7 Plus
SafetyFree to use under the Unsplash License
pacific coast highwaylos angelesunited statesroadfreewayhighwaytarmacasphalttransportationCar images & picturesvehicleautomobileurbanmetropolisbuildingHd city wallpaperstownPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

vision board 9/2021
35 images · Curated by Eleni Bandy
visionboardWebsite backgrounds
nature
19 images · Curated by Rosamund Berdann
Nature imagesFlower imagesplant
Malibu Rising
25 images · Curated by Lauren Wiegand
malibuoutdoorsea