Download free
black asphalt road between trees covered with snow during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

black asphalt road between trees covered with snow during daytime

Download this free HD photo of grey, road, ice, and snow by John Thomas (@capturelight)

Calendar outlinedPublished on CameraCanon, EOS 6D Mark II
SafetyFree to use under the Unsplash License
Hd grey wallpapersroadiceHd snow wallpapersfogMountain images & picturesutahroadtripWinter images & picturesHd epic wallpaperstunneladventureNature imagesoutdoorsasphalttarmacfreewayhighwayfrostPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Roads Away
161 images · Curated by Andi Wieser
roadhighwayfreeway
Minimal
1,283 images · Curated by Daize
minimalgrigiotesto
Winter
102 images · Curated by Blake Barbeau
Winter images & picturesHd grey wallpapersoutdoor