Download free
black and white corded device
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial
1,000,000+ Free Images › Stock Photos & Images › Historical Photos & Images

black and white corded device

Download this free HD photo of dark, grey, moody, and road by Alan Labisch (@labisch)

Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D750
SafetyFree to use under the Unsplash License
Hd dark wallpapersHd grey wallpapersmoodyroadTree images & picturesfogNature imageshazegiantTree images & picturessequoiaredwoodtarmacasphaltfreewayhighwayplantoutdoorsfirabiesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Landscapes/ Nature
16 images · Curated by Sandy Washington
outdoorHd grey wallpapersStar images