Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Go to Tyler Hardie's profile
Tyler Hardie
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
Begin work zone, double penalties in work zones sign
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Begin work zone, double penalties in work zones sign

Download this free HD photo of blue, construction, road, and work by Tyler Hardie (@tylersphotographyus)

Calendar outlinedPublished on May 5, 2026 (UTC)CameraSafetyFree to use under the Unsplash License
blueconstructionroadworkredsafetydrivingsignwarningtealroad signregulationalertunder constructionsignageroad safetylegal compliancepublic safetyroad worktraffic signPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20