Download free
assorted-color concrete buildings
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

assorted-color concrete buildings

Colors of Magstræde

A map markerMagstræde, København, Denmark
Calendar outlinedPublished on SafetyFree to use under the Unsplash License
magstrædekøbenhavndenmarksidewalkpavementwalkwaycobblestonepathHd brick wallpapersstreeturbantownbuildingHd city wallpapersroadalleyalleywayhousingHouse imagesvillaPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

DanCenter
33 images · Curated by Stefan Fritsche
dancenterdenmarkHd grey wallpapers
Creative pic ideas
41 images · Curated by Kristine Stewart
ideapicHd grey wallpapers