Download free
asphalt road with mountain background
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

asphalt road with mountain background

Download this free HD photo of grey, road, mountains, and blue by Jordan McGee (@jordanmcgee)

Calendar outlinedPublished on CameraCanon, EOS 5D Mark IV
SafetyFree to use under the Unsplash License
Hd grey wallpapersroadMountain images & picturesHd blue wallpapershighwayfreewaytarmacasphaltoutdoorsNature imagestentPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Road
207 images · Curated by Maria
roadHd grey wallpapersoutdoor
Landscape
139 images · Curated by Rayna Nikolova
Landscape images & picturesoutdoorHd wallpapers
Wallpapers
47 images · Curated by RainRaven Windwalker
Hd wallpapersoutdoorHq background images