Download free
an empty road with trees on both sides
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

an empty road with trees on both sides

Download this free HD photo of uruguay, maldonado, road, and natural background in Uruguay by luciano paris (@lucianoparis)

A map markerMaldonado, Uruguay
Calendar outlinedPublished on CameraCanon, EOS M
SafetyFree to use under the Unsplash License
uruguaymaldonadoroadnatural backgroundpaisaje naturalroutenaturalbosquesforesrtplantTree images & picturesfirabiesasphalttarmachighwayfreewayconiferoutdoorsGrass backgroundsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

[Beach Vibes]
62 images · Curated by Arielle Jagow
Beach images & picturesoutdoorsea
PATTERNS
52 images · Curated by Annaïk ANYOUZO'O BRIGNOL
Hd pattern wallpapersHq background imagesTexture backgrounds