Download free
alley photography of walkway between building during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

alley photography of walkway between building during daytime

Download this free HD photo of lisbon, path, walkway, and sidewalk by Tom Byrom (@tombyrom)

Calendar outlinedPublished on CameraSONY, ILCE-6000
SafetyFree to use under the Unsplash License
lisbonpathwalkwaysidewalkpavementflagstonecobblestonePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Aerial
353 images · Curated by Adam Mechedal
aerialaerial viewdrone
Technology
70 images · Curated by Unsplash+ Collections
technologyelectronicHd computer wallpapers