Download free
aerial view of road near body of water during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

aerial view of road near body of water during daytime

Download this free HD photo of grey, road, freeway, and highway by Long Truong (@longtruong)

Calendar outlinedPublished on CameraCanon, EOS 80D
SafetyFree to use under the Unsplash License
Hd grey wallpapersroadfreewayhighwaytarmacasphalthumanPeople images & picturesHd scenery wallpapersNature imagesoutdoorsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

places.
8,671 images · Curated by Hannah Smith
placebuildingoutdoor
city
30 images · Curated by Bailey Nester
Hd city wallpapersbuildingurban
Positive thoughts
187 images · Curated by Fernando Aughusto
humanoutdoorHd art wallpapers