Download free
aerial view of city under cloudy sky
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

aerial view of city under cloudy sky

LA Cityscape

A map markerLos Angeles, United States
Calendar outlinedPublished on CameraCanon, EOS REBEL T5i
SafetyFree to use under the Unsplash License
los angelesHd grey wallpapersunited statesHd city wallpapersLandscape images & picturesurbanaeriallacityscapeskylineviewviewpointSunset images & picturesHd scenery wallpapersNature imagesoutdoorsaerial viewbuildingtowndowntownPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Communities
19 images · Curated by Peter Koechley
communitybuildingHd grey wallpapers
moody
72 images · Curated by SKAT
moodyoutdoorSunset images & pictures
Kristen
7 images · Curated by Elayna Alexandra
kristenlos angelesoutdoor