Download free
aerial photography of city
– –––– –.
––– – ––– –––
– –––– –.
––– – ––– –––

aerial photography of city

Download this free HD photo of tucson, downtown tucson, nightlife, and road in Tucson by Andrew Ling (@linginit)

A map markerTucson
Calendar outlinedPublished on CameraCanon, EOS 600D
SafetyFree to use under the Unsplash License
tucsondowntown tucsonnightliferoadintersectionbuildingtownurbanHD City WallpapersmetropolisdowntownfreewaytarmacasphaltarchitecturebanisterhandrailPeople Images & PictureshumanoutdoorsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Tucson
4 images · Curated by Marisa Dominguez
tucsonCar Images & PicturesLight Backgrounds
Tucson
12 images · Curated by Ryan G.
tucsonoutdoorusa
Arizona US
21 images · Curated by Lesly Scott
arizonaoutdoorusa