Download free
adult brown Labrador retriever
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

adult brown Labrador retriever

Mountain Pup

Calendar outlinedPublished on CameraCanon, EOS 5D Mark III
SafetyFree to use under the Unsplash License
Dog images & picturespointerAnimals images & picturesportraitmountain dogvizslacampingDog images & picturesprofilecompanionFamily images & photosLove imageswalkscarfharnesshikingcamp dogPuppies images & picturesperroPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Dogs camping
19 images · Curated by Liv Pignataro
campingDog images & picturespet