Download free
people crossing a street
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

people crossing a street

Download this free HD photo of valle aurina, autonomous province of bolzano – south tyrol, italy, and road in Valle Aurina, Italy by Matteo Badini (@teobadini)

A map markerValle Aurina, Autonomous Province of Bolzano – South Tyrol, Italy
Calendar outlinedPublished on CameraFUJIFILM, X-T30
SafetyFree to use under the Unsplash License
valle aurinaautonomous province of bolzano – south tyrolItaly pictures & imagesroadtarmacasphaltmetropolisclothingapparelintersectionstreetbikebicycletransportationvehiclepathwheelmachinefemalezebra crossingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Health & Fitness
111 images · Curated by Unsplash Archive
fitnessHealth imageswellness
Insomnia
30 images · Curated by Natalie Brennan
insomniumHd wallpapersHq background images