Download free
a very long hallway with a bunch of arches
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a very long hallway with a bunch of arches

Download this free HD photo of mu'tah, jordan, corridor, and mosque in Mu'tah, Jordan by Abizer Shihorwala (@abzier)

A map markerMu'tah, Jordan
Calendar outlinedPublished on SafetyFree to use under the Unsplash License
mu'tahjordancorridormosquearchesarchedbuildingindoorsfloorflooringwalkwaypatharchcryptflagstonePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Analytics
47 images · Curated by Ginette Methot
analyticWebsite backgroundswork