Download free
a train traveling down train tracks next to a mountain
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a train traveling down train tracks next to a mountain

Little nice town called Rakhiv in Ukrainian

A map markerРахів, Рахів, Україна
Calendar outlinedPublished on CameraApple, iPhone 13 Pro
SafetyFree to use under the Unsplash License
рахівукраїнаukrainetrainstationtrainscarpathiansmounatinsfoggytrain trackrailwaytrainvehiclerailwheelmachinelocomotivePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

atmosphere
125 images · Curated by helen wyllie
atmosphereHd wallpapersHq background images
Spring
246 images · Curated by Wendy Heeder
Spring images & picturesplantFlower images