Download free
a street filled with lots of smoke next to a building
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –
HQ Background Images › Art Backgrounds › Abstract Backgrounds

a street filled with lots of smoke next to a building

Gilets jaunes, yellow vests protests, january 2019 in Lyon, France. Many clashes against police and gendarmerie, with tear gas

A map markerLyon, France
Calendar outlinedPublished on CameraCanon, EOS 1100D
SafetyFree to use under the Unsplash License
yellow vests mouvementtarmacasphalthumanPeople images & picturesSmoke backgroundstownurbanHd city wallpapersmetropolisbuildingfreewayhighwayvehicletransportationtruckmachinetrainlocomotivespokePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Urban Folk
276 images · Curated by Clem Onojeghuo
urbanPeople images & picturesman