Download free
a stone staircase in a stone building
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a stone staircase in a stone building

Download this free HD photo of oldvillage, stones, staircase, and walkway by Cécile Z. (@cecilez)

Calendar outlinedPublished on CameraApple, iPhone 7
SafetyFree to use under the Unsplash License
oldvillageBest stone pictures & imagesstaircasewalkwaypathflagstoneHd grey wallpaperscryptbuildingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Her
659 images · Curated by Heather Dou
herWomen images & picturesPeople images & pictures
marine
129 images · Curated by Jenna S
marineseaHd blue wallpapers
Super Bowl
74 images · Curated by Unsplash+ Collections
Sports imagesamerican footballfitness