Download free
a stone path with a stone wall and a building on the side
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a stone path with a stone wall and a building on the side

Astrakhan Kremlin

A map markerAstrakhan, Astrakhan, Russia
Calendar outlinedPublished on CameraApple, iPhone XS
SafetyFree to use under the Unsplash License
russiaastrakhantowerwallarchitecturekremlinBrown backgroundspathwalkwaypavementsidewalkcobblestoneflagstoneBirds imagesAnimals images & picturesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections