Download free
a statue of a person dressed in a costume
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a statue of a person dressed in a costume

Harikrishna Maharaj

Calendar outlinedPublished on SafetyFree to use under the Unsplash License
adultWedding backgroundsPeople images & picturesbrideWomen images & picturesfemalefaceheadaccessoriesnecklacejewelryfestivalharikrishnamaharajGod images & picturesswaminarayanvadtalPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20