Download free
a small stream running through a mountain side
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a small stream running through a mountain side

Download this free HD photo of zell am see, österreich, music, and zeller see by Stock Birken (@stockbirken)

A map markerZell am See, Österreich
Calendar outlinedPublished on CameraCanon, EOS 6D Mark II
SafetyFree to use under the Unsplash License
zell am seeösterreichMusic images & pictureszeller seeworkspaceworkHd water wallpaperssnackservicesreflectionplacesPeople images & picturesparksHd ocean wallpapersoccasionsNature imagesMountain images & picturesmotor vehiclemeetingjapanPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Technology
268 images · Curated by Jeremy Beck
technologyelectronictech
Street Life Photowalk
869 images · Curated by Chris Barbalis
StreethumanPeople images & pictures
Astrology
95 images · Curated by Unsplash+ Collections
Astrology pictureshoroscopezodiac sign