Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to James Trenda's profile
James Trenda
trendagraphy
Edit image Plus sign for Unsplash+
Download free
a small gold coin on a black and white spotted spotted spotted surface
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

a small gold coin on a black and white spotted spotted spotted surface

An open umbrella with a leopard skin pattern.

Calendar outlinedPublished on July 12, 2022 (UTC)CameraSafetyFree to use under the Unsplash License
leopardsafariumbrellaleopard printcheetah printtananimal printleopard patternanimal skinspotsneutralsleopard skinanimalpatternwildlifecheetahjaguarpanthermammalrugPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20