Download free
a shadow of a person standing in front of a trailer
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a shadow of a person standing in front of a trailer

Download this free HD photo of street capture, contrastphotography, grainyfilm, and retrophotography by Yves Cedric Schulze (@yvced)

Calendar outlinedPublished on CameraFujifilm eSystems, Inc., Digital Link
SafetyFree to use under the Unsplash License
street capturecontrastphotographygrainyfilmretrophotographymoodymonochromenoirphotographyvintagestyleclassicfilmfilmnoirmonochromeblackandwhitephotographycity life vibesstreet photographercity view photographycity explorercity sightsstreet view photographycity life scenescity discoveriesurban photographyPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections