Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Go to Ozzie Kirkby's profile
Ozzie Kirkby
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
a scooter is parked in front of a building
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

a scooter is parked in front of a building

Download this free HD photo of black, city, building, and road in Taiwan by Ozzie Kirkby (@ozziek)

A map markerTaipei, Taiwan
Calendar outlinedPublished on November 2, 2023 (UTC)CameraSafetyFree to use under the Unsplash License
blackcitybuildingroadplantstreeturbanmotorcyclevehiclepathtaiwanmachineneighborhoodoutdoorswheeltaipeiscooterpotted planttarmacwalkwayPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20