Download free
a row of cars parked next to each other
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a row of cars parked next to each other

Download this free HD photo of porsche, ferrari logo, red ferrari, and ferrari f8 tributo by Carl Gelin (@photobycarl)

Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D7500
SafetyFree to use under the Unsplash License
porscheferrari logored ferrariferrari f8 tributoHd ferrari wallpaperspetrolheadracedayHd lamborghini wallpapersaerodynamicsdownforceswaggerlifestylehypercarsracingracetracktrackdayracecarsluxurycarssupercarssportscarsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Collection #176: Unsplash
9 images · Curated by Unsplash Archive
Hd wallpapersoutdoorBirds images
Sports from Above
36 images · Curated by Willian Justen de Vasconcellos
Sports imagescourtdrone